*For Research use only
VIP10 is a synthetic research peptide supplied for laboratory and analytical chemistry applications. This material is intended for controlled research environments where peptide identity, sequence characteristics, molecular structure, solubility, stability, and analytical profile may be evaluated using appropriate laboratory methods.
VIP10 is typically supplied as a lyophilized powder and should be handled according to standard laboratory procedures for synthetic peptide research materials. This product description is strictly chemistry-focused and intended for informational research-use positioning only.
Product Name: VIP10 10mg
Compound Type: Synthetic Research Peptide
Physical Form: Lyophilized Powder
Product Size: 10mg
Research Category: Peptide Chemistry / Analytical Research
CAS Number: 40077-57-4
Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Molecular Formula: C147H238N44O42S
Molecular Weight: ~3325.7–3326 g/mol
VIP10 is categorized as a peptide research material. Its final chemical profile may depend on the referenced sequence, salt form, counterion profile, residual moisture, manufacturing process, and batch-specific documentation. Exact molecular data should be verified using supplier specifications or a lot-specific certificate of analysis when available.
VIP10 is associated with a peptide-based molecular framework composed of amino acid residues connected through peptide bonds. Depending on the referenced sequence and material form, the structure may include polar side-chain regions, charged functional groups, terminal modifications, or salt-form-dependent characteristics.
Because VIP10 may be referenced differently across suppliers or research catalogs, sequence-level confirmation should be based on verified product documentation. Molecular formula, molecular weight, purity, counterion profile, and assay values should only be listed when supported by supplier records or a current lot-specific COA.
VIP10 10mg is intended for laboratory research use only. It is not intended for human or animal consumption, clinical use, diagnostic use, food use, supplement use, cosmetic use, household use, or any application outside of controlled research environments.
Premium research-grade peptides for optimal controlled studies and performance. Third-party tested with Certificate of Analysis
All products sold on isopepsciences.com are research-grade compounds intended exclusively for in-vitro laboratory study by qualified researchers. They are not drugs, dietary supplements, cosmetics, or food products, and they are not for human or veterinary use, consumption, or ingestion in any form.
Statements made on this website have not been evaluated by the U.S. Food and Drug Administration. These compounds are not intended to diagnose, treat, cure, or prevent any disease, and their efficacy has not been confirmed by FDA-approved research.
By placing an order, you confirm that you are a qualified researcher acquiring these materials strictly for laboratory research, and you accept full responsibility for their lawful and appropriate use.
Copyright@2026 isopepsciences. All Right Reserved
Drop your email — we'll send a one-time code, plus a quick guide on how to read your Certificate of Analysis.
We just sent your 10% off code to .
Tip: if you don't see it in Primary, check your Promotions tab and drag it to Primary so future emails come straight in.
By entering your email you agree to receive occasional updates from IsoPep Sciences. Unsubscribe anytime.