LL-37 is a synthetic research peptide supplied for laboratory and analytical chemistry applications. This material is intended for controlled research environments where peptide identity, sequence structure, molecular characteristics, solubility, stability, and analytical profile may be evaluated using appropriate laboratory methods.

LL-37 is typically supplied as a lyophilized powder and should be handled according to standard laboratory procedures for synthetic peptide materials. This product description is strictly chemistry-focused and intended for informational research-use positioning only.

Chemical Profile

Product Name: LL-37 5mg
Compound Type: Synthetic Research Peptide
Peptide Class: Long-Chain Peptide
Sequence Length: 37 amino acids
Common Sequence Reference: [LL-37, 37 aa]
Physical Form: Lyophilized Powder
Product Size: 5mg
Research Category: Peptide Chemistry / Analytical Research
Molecular Formula: Not specified without batch-specific documentation
Molecular Weight: Not specified without batch-specific documentation

LL-37 is a 37-residue synthetic peptide with a defined amino acid sequence and a relatively large peptide framework. Its final analytical profile may vary depending on salt form, counterion profile, residual moisture, manufacturing process, and batch-specific documentation.

Structural Characteristics

LL-37 contains a long-chain amino acid sequence composed of hydrophobic, polar, acidic, and basic residues. The sequence begins with two leucine residues, which is reflected in the LL-37 naming convention, and includes multiple charged side-chain regions distributed across the peptide structure.

Due to its length and amino acid composition, LL-37 may present distinct analytical characteristics compared with shorter peptides, including sequence-dependent chromatographic behavior, mass verification requirements, and solubility considerations. Exact molecular data, salt form, purity, and assay information should be verified against supplier documentation or a lot-specific certificate of analysis when available.

Analytical Considerations

LL-37 may be evaluated using standard analytical methods commonly applied to synthetic peptide research materials. These may include identity confirmation, mass verification, chromatographic purity assessment, appearance inspection, and batch consistency review.

Batch-specific values such as purity percentage, assay amount, residual solvents, water content, heavy metals, microbial limits, counterion profile, or pass/fail results should only be stated when supported by a current lot-specific certificate of analysis. In the absence of a COA, analytical language should remain general and informational.

Handling & Storage

LL-37 should be handled only in an appropriate laboratory setting using procedures suitable for synthetic peptide materials. The vial should remain sealed when not in use and should be protected from unnecessary exposure to moisture, air, direct light, and elevated temperatures.

Recommended storage and handling considerations include:

• Store sealed and dry
• Protect from direct light
• Minimize exposure to humidity
• Maintain cold-storage conditions for long-term stability
• Avoid repeated temperature cycling
• Minimize exposure to open air
• Handle with appropriate laboratory PPE
• Follow applicable laboratory safety procedures

Storage behavior may vary depending on salt form, residual moisture, container closure, and batch-specific documentation.

Research Use Disclaimer

LL-37 5mg is intended for laboratory research use only. It is not intended for human or animal consumption, clinical use, diagnostic use, food use, supplement use, cosmetic use, household use, or any application outside of controlled research environments.