*For Research use only
LL-37 is a synthetic research peptide supplied for laboratory and analytical chemistry applications. This material is intended for controlled research environments where peptide identity, sequence structure, molecular characteristics, solubility, stability, and analytical profile may be evaluated using appropriate laboratory methods.
LL-37 is typically supplied as a lyophilized powder and should be handled according to standard laboratory procedures for synthetic peptide materials. This product description is strictly chemistry-focused and intended for informational research-use positioning only.
Product Name: LL-37
CAS Number: 597562-32-8
Compound Type: Synthetic Research Peptide
Peptide Class: Long-Chain Peptide
Sequence Length: 37 amino acids
Common Sequence Reference: [LL-37, 37 aa]
Three-Letter Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Physical Form: Lyophilized Powder
Product Size: 5mg
Research Category: Peptide Chemistry / Analytical Research
Molecular Formula: C205H340N60O53
Molecular Weight: 4493.37 g/mol
LL-37 is a 37-residue synthetic peptide with a defined amino acid sequence and a relatively large peptide framework. Its final analytical profile may vary depending on salt form, counterion profile, residual moisture, manufacturing process, and batch-specific documentation.
LL-37 contains a long-chain amino acid sequence composed of hydrophobic, polar, acidic, and basic residues. The sequence begins with two leucine residues, which is reflected in the LL-37 naming convention, and includes multiple charged side-chain regions distributed across the peptide structure.
Due to its length and amino acid composition, LL-37 may present distinct analytical characteristics compared with shorter peptides, including sequence-dependent chromatographic behavior, mass verification requirements, and solubility considerations. Exact molecular data, salt form, purity, and assay information should be verified against supplier documentation or a lot-specific certificate of analysis when available.
LL-37 5mg is intended for laboratory research use only. It is not intended for human or animal consumption, clinical use, diagnostic use, food use, supplement use, cosmetic use, household use, or any application outside of controlled research environments.
Premium research-grade peptides for optimal controlled studies and performance. Third-party tested with Certificate of Analysis
All products sold on isopepsciences.com are research-grade compounds intended exclusively for in-vitro laboratory study by qualified researchers. They are not drugs, dietary supplements, cosmetics, or food products, and they are not for human or veterinary use, consumption, or ingestion in any form.
Statements made on this website have not been evaluated by the U.S. Food and Drug Administration. These compounds are not intended to diagnose, treat, cure, or prevent any disease, and their efficacy has not been confirmed by FDA-approved research.
By placing an order, you confirm that you are a qualified researcher acquiring these materials strictly for laboratory research, and you accept full responsibility for their lawful and appropriate use.
Copyright@2026 isopepsciences. All Right Reserved
Drop your email — we'll send a one-time code, plus a quick guide on how to read your Certificate of Analysis.
We just sent your 10% off code to .
Tip: if you don't see it in Primary, check your Promotions tab and drag it to Primary so future emails come straight in.
By entering your email you agree to receive occasional updates from IsoPep Sciences. Unsubscribe anytime.